Разное

Вещество белки: Белки, жиры, углеводы. Справка — РИА Новости, 23.08.2010

Содержание

Белки  — ФГБУ «НМИЦ ТПМ» Минздрава России

Белки представляют основу структурных элементов клеток и тканей. Функции их разнообразны, они принимают участие в обмене веществ, сократимости, росте, размножении, мышлении.

  
Еще одна функция белков — транспортировка необходимых соединений или химических элементов. Гемоглобин, например, переносит кислород, он же транспортирует углекислый газ.

При попадании в организм чужих белков или клеток вырабатываются особые белки — антитела, которые связывают и обеззараживают чужеродные вещества.

И наконец, белки могут служить источником энергии. Но это самое невыгодное «топливо». В сутки в организме человека расщепляется около 400 г белка. Две трети образовавшихся при этом аминокислот идут на восстановление белка, и одна треть расходуется на образование энергии.

В раннем детстве потребность в белке максимальная. С возрастом она уменьшается, так как ткани наращиваются медленнее. К моменту зрелости главной становится не строительная функция, а энергетическая.

  
Организм не может принять белка больше, чем ему необходимо, и если потребление белка с возрастом не уменьшается, то образуются конечные продукты белкового обмена: мочевая кислота, мочевина, аммиак, креатинин, креатин и др. При избытке этих соединений выведение их затруднено, и они задерживаются в организме, постепенно накапливаясь и нарушая обменные процессы.

  
Все огромное множество белков — это комбинации 20 аминокислот, из них 10 аминокислот не синтезируются организмом и могут быть получены только из продуктов питания. Эти незаменимые аминокислоты должны поступать в составе потребляемых нами белков. 
Белки пищи могут быть животного и растительного происхождения. Ценность пищевого рациона определяется наличием в белке незаменимых аминокислот.

  
К полезным животным белкам относятся постная говядина, курятина и индюшатина без кожи, яйца, молочные и кисломолочные продукты. 
Рыба является не только источником белка, но и обеспечивает нас полезными омега-3-жирными кислотами.

Белки растительного происхождения (фасоль, соя, горох, чечевица) сочетают в себе высококачественный белок и растворимое волокно, которое очищает организм от холестерина. 
Орехи и семена богаты не только белками, но и мононенасыщенными жирами.

Грецкие орехи содержат еще и омега-3-жирные кислоты. Это делает их особенно полезными, однако они содержат много калорий, поэтому потреблять их в большом количестве не следует.

Белок — все статьи и новости

Белок — сложное органическое вещество, которое состоит из 20 аминокислот, связанных между собой пептидной связью, и является особенно значимым для процессов жизнедеятельности любого организма. Белки, например, управляют экспрессией генов — процессом, в ходе которого наследственная информация от генов преобразуется в РНК или белок. Поэтому другое название этих соединений — протеины, что в переводе с греческого означает «первый» или «главный». Свое русское наименование белки получили по веществу, обнаруженному в птичьих яйцах, которое при нагревании имеет свойство сворачиваться в массу белого цвета.

В живом организме среди всех имеющихся соединений больше всего именно аминокислотных. К настоящему моменту ученые смогли исследовать примерно 3 млрд белков, в человеческом организме удалось зафиксировать около 50 тысяч. Весь обнаруженный массив было принято делить на группы по различным признакам. Белки, напоминающие своей формой шар, называют глобулярными, а те, которые больше походят на вытянутую нить, — фибриллярными. По выполняемым в организме функциям данные соединения делятся на структурные, придающие клеточным тканям специальную форму; каталитические, или ферменты, ускоряющие биохимические реакции; регуляторные, к которым относится большинство гормонов, поддерживающих в организме необходимый баланс; защитные, которые способны узнавать и при необходимости атаковать чужеродные тела (к этой группе относятся белки, участвующие в процессе свертывания крови). Важным источником белков, не синтезируемых в человеческом организме, являются продукты животного происхождения.

Изучение белков ведется с конца XVIII века. Мощный рывок в биохимических исследованиях был сделан во второй половине XIX столетия, когда Теодор Шванн и Жан Корвизар установили, что белки образуются из аминокислот. Среди отечественных ученых особых высот в изучении белков достиг Владимир Энгельгардт. Ему принадлежат работы об антиферментах, свойствах гемоглобина и методов консервирования крови.

Источник картинки: http://wb.md/1oNaFaj

Белок — важная составляющая каждой клетки нашего организма

Белок — важная составляющая каждой клетки нашего организма.

Человек нуждается в наборе конкретных пищевых веществ – белков, жиров, углеводов, витаминов, минеральных веществ. Белки – это органические вещества животного и растительного происхождения, которые обеспечивают поддержку клеток человеческого организма. Их основным элементом являются многочисленные аминокислоты.

Белки называют пищей роста. Они представляют собой как бы каркас, который обеспечивает структурными элементами каждую клетку тела. Белки ответственны за рост, восстановление и замену тканей. Белки – единственный питательный элемент, который может сам себя дублировать. Ткани растут за счёт нагромождения друг на друга миллионов белковых молекул, пока каждый орган не достигнет своего полного развития, после чего, они заменяются новыми.

Белок можно сравнить с длинным жемчужным ожерельем, где каждая жемчужинка – это аминокислота, маленькая частичка белка.

Весьма популярна такая неправильная концепция питания: если питательное вещество полезно, то его должно быть много! Это заблуждение. Организму необходимо определённое количество каждого жизненно важного питательного вещества; если его мало – организм не может функционировать нормально, если слишком много – это дополнительная нагрузка для него. То же относится и к белкам. При избыточном поступлении белка организм начинает работать с нагрузкой, стараясь распределить калории. Человек расплачивается за это неправильным обменом веществ.

Белок также способствует более медленному подъему и падению уровня сахара и инсулина в крови, поэтому Вы можете избежать «скачков сахара» после того, как поели сладостей без соответствующего количества белка.

При недостаточном количестве белка в пище снижается работоспособность человека и сопротивляемость его организма к инфекционным заболеваниям. Наиболее выразительные признаки дефицита белка в организме — это потеря памяти и ослабле¬ние умственных возможностей, потеря сопротивляемости организма, образование целлюлита, исчезновение женского физиологического цикла или нарушение его нормального протекания.

Организму требуется 22 вида аминокислот, из них только 13 видов он может синтезировать сам. Остальные же 9 аминокислот, называемых незаменимыми, он должен получать с продуктами питания. Белки, содержащие все 9 незаменимых аминокислот, называются полноценными. Мясо, рыба, куры, яйца, молочные продукты, – вот главные источники полноценных белков. Овощи, крупы, злаковые и особенно бобовые (сухой горох, соя, чечевица, бобы) – отличные источники белков, называемых неполноценными, поскольку в них содержатся многие, но не все аминокислоты, в разных соотношениях.

Сбалансированное питание – это получение организмом всего набора незаменимых аминокислот вследствие сочетания овощей, злаковых, молочных и мясных продуктов.

Вот перечень продуктов – источников белка, в убывающей последовательности:

  • Морские продукты: треска, палтус, горбуша, меч-рыба и др.
  • Яйца.
  • Молочные продукты: творог, йогурт, сыры, молоко.
  • Бобовые.
  • Мясо и птица.
  • Орехи, семечки подсолнуха, кунжута, кэшью.
  • Злаковые: пшеница, рожь, овёс, кукуруза, просо.
  • Овощи: картофель, зелёный горошек, брокколи, морковь.
Список литературы
  1. Гогулан, М. Законы полноценного питания / М. Гогулан. – М.: АСТ: Астрель; Владимир: ВКТ, 2010. – 46 с.
  2. Кольяшкин, М.А. Лечебное питание : домашний справочник / М.А. Кольяшкин, Н.Н. Полушкина. – Ростов н/Д.: Феникс, 2009. – 254 с.
  3. Литвина, И.И. Три пользы / И.И. Литвина. – М.: Физкультура и спорт, 1989. – 208 с.
  4. Ноукс, М., Клифтон, П. Еда для долголетия / М. Ноукс, П. Клифтон. – М.: ЗАО «ОЛМА Медиа Групп», 2010. – 224 с.
  5. Популярно о питании / Под ред. проф. А.И. Столмаковой и канд. мед. наук И.О. Мартынюка. – Киев: Изд-во «Здоровья», 1989. – 272 с.

Версия для печати

Белок: что это, функции в организме и нормы

Материал проверила и прокомментировала Горбачёва Наталья Леонидовна, диабетолог, диетолог, эндокринолог, ведущий специалист сети клиник «Семейная»

Что такое белок

Белки — главный строительный материал организма. Он участвует в создании мышц, сухожилий, органов и кожи, а также нужен для производства ферментов, гормонов, нейромедиаторов и различных молекул, которые выполняют множество важных функций. Белки состоят из более мелких молекул, аминокислот, которые соединяются вместе, как бусы на нитке. Эти связанные аминокислоты образуют длинные белковые цепи, которые затем складываются в сложные формы. Некоторые аминокислоты организм производит самостоятельно, другие можно восполнить только с помощью еды.

Функции белка в организме

Рост мышц и повышение выносливости

Организму необходим протеин, ведь мышцы в основном состоят из белка. Как и большинство тканей тела, мышцы динамично разрушаются и восстанавливаются, поэтому им необходим строительный материал для роста. Чтобы мышечная масса увеличивалась, в организме должен быть положительный белковый баланс. Его также называют азотным, из-за высокого содержания этого элемента в протеине. Употребление белка помогает не только нарастить мышцы при занятиях спортом, но и предотвратить их потерю, если вы придерживаетесь строгих диет [1] [2].

Биохимические процессы

Белки — ферменты, они помогают тысячам биохимических реакций, происходящих внутри клеток организма [3]. В том числе активируют метаболизм посредством объединения с другими молекулами — субстратами. Ферменты также могут функционировать и вне клетки, например, пищеварительные — лактоза и сахароза, которые помогают переваривать сахар. От их количества зависит пищеварение, свертывание крови и энергетический баланс. Дисбаланс некоторых ферментов может привести к сбоям в работе большинства систем организма [4].

Гормональный баланс

Некоторые белки представляют собой гормоны, которые как химические посредники помогают взаимодействовать различным клеткам организма. Их производят эндокринные ткани и железы, а затем белки транспортируются по внутренним органам. Эти гормоны делят на три группы: белок и пептиды, стероиды и амины [5].

Структура тканей

Некоторые белки являются волокнами, придающими жесткость клеткам: кератин, коллаген и эластин. Они помогают формировать каркас тканей тела [6]. Кератин — строительный материал для кожи, волос и ногтей, коллаген — структурный белок костей, кожи, связок и сухожилий, а эластин позволяет тканям возвращаться в первоначальную форму после растяжений и сокращений.

Правильный pH

Белок играет жизненно важную роль в регулировании концентрации кислот и оснований в крови и других жидкостях организма [7]. Этот баланс измеряется с помощью шкалы pH от 0 до 14, где 0 — максимально кислый, 7 — нейтральный, 14 — наиболее щелочной. Протеины — один из способов регулирования этих показателей. Например, гемоглобин — тоже белок, из которого состоят эритроциты. Он связывает небольшое количество кислоты, помогая поддерживать нормальный уровень pH в крови.

Хороший иммунитет

Белки помогают формировать иммуноглобулины или антитела для борьбы с инфекцией [8] [9]. Антитела — белки в крови, которые помогают защитить организм от бактерий и вирусов. Вырабатывая их в качестве реакции на вторжение чужеродных элементов, клетки в дальнейшем лучше противостоят похожим заболеваниям.

Баланс жидкости

Альбумин и глобулин — белки крови, которые помогают сохранить баланс жидкости в организме, удерживая воду в клетках [10] [11]. При недостатке протеина могут возникать отеки, так как жидкость вытесняется в промежутки между клетками [12].

Нормализация веса

Белок важен для тех, кому необходимо нормализовать вес. Некоторые эксперименты ученых подтверждают, что увеличение количества белка в рационе ведет к повышению скорости метаболизма и снижению аппетита [13]. Протеин хорошо насыщает, в результате чего реже хочется перекусывать, снижается объем порций в основных приемах пищи [14] [15]. В одном из исследований женщины 12 недель употребляли белковую пищу в количестве 30% от дневной калорийности рациона. В среднем каждая из участниц эксперимента потеряла порядка пяти килограмм веса, сохранив здоровые пищевые привычки [16].

Норма белка в день

Если вы каждый день едите продукты животного происхождения, такие как мясо, рыбу, яйца или молочные продукты, вы, вероятно, получаете достаточно белка. Если придерживаетесь растительной диеты, получить незаменимые аминокислоты, необходимые организму, будет сложнее. Среднестатистические нормы протеина в рационе на один килограмм веса:

  • для женщин – 60–90 г;
  • для мужчин – 80–150 г;
  • для дошкольников – 3 г;
  • для школьников – 2,5 г.

В некоторых случаях требуется больше белка, например, в периоды болезни, интенсивных занятий спортом, а также при беременности и кормлении грудью [17] [18]. Данные о точном количестве вещества разнятся, поэтому правильно будет проконсультироваться с лечащим врачом, который подберет индивидуальный рацион, исходя из особенностей организма. Так, авторы одного исследования утверждают, что беременным женщинам в день необходимы 1,2–1,52 г протеина на один кг веса [19]. Другие врачи рекомендуют потреблять дополнительно 1,1г белка на кг веса [20]. Суточная норма белка во время грудного вскармливания составляет 1,3 г на килограмм в день плюс 25 дополнительных граммов [21].

Активным людям требуется больше белка, чем тем, кто ведет малоподвижный образ жизни. Спортсменам, предпочитающим тренировки на выносливость, необходимо около 1,2–1,4 г на каждый кг веса [22] [23]. Достаточное количество протеина необходимо для предотвращения развития заболеваний, таких как остеопороз. Пожилым людям, а также тем, кто восстанавливается после травмы или операции, требуется до 1–1,3 г на один кг массы тела [24] [25].

Сколько белка в яйцах, курице и твороге

Эти продукты врачи и диетологи чаще всего упоминают как отличные источники протеина:

  1. Яйца. Содержат 6-7 г белка на штуку среднего размера. Содержатся они именно в белковой части яйца. Поэтому в фитнес-меню часто присутствуют блюда без желтка, но на самом деле, при сбалансированном рационе нет смысла от них отказываться.

  2. Курица. Если необходимо добавить белка в рацион, выбирайте куриную грудку — в ней больше волокон и меньше жира. На 100 г продукта — 27% белка. Оптимальный ингредиент для повышения уровня белка в организме, если вы не придерживаетесь растительной диеты.

  3. Творог. В 200-граммовой пачке творога содержится 35 г белка, что соответствует почти трети среднестатистической дневной нормы. Отдавайте предпочтение творогу средней жирности, так как обезжиренного усваивается меньше необходимым микроэлементов.

Продукты, богатые белком

В первую очередь, протеин попадает в организм из животных продуктов. Средние показатели белка на 100 г продукта:

  • птица — 27 г;
  • свинина — 27 г;
  • говядина — 26 г;
  • рыба — 22 г;
  • морепродукты — 22 г.

Вегетарианцам и веганам стоит позаботиться о наличии растительного белка в рационе. Это могут быть бобовые, крупы, соевые и цельнозерновые продукты:

  • красная чечевица — 18 г белка;
  • красная фасоль — 16 г;
  • маш, нут, черная фасоль — 14 г;
  • гречка и цельнозерновой хлеб — 13 г;
  • киноа и тофу — 8 г;
  • тыквенные семечки — 5 г в одной порции (горсть 25-30 г).

Норма белка в моче и крови

Лучший способ проверить, хватает ли организму белка, — сдать анализы, например биохимический анализ крови. В норме концентрация белка в крови взрослого человека должна составлять 62–86 г/л, а у детей — от 45 до 80 г/л. Снижение этих показателей возникает в результате ряда заболеваний, в том числе первичных иммунодефицитов, нарушениях обмена веществ, дисфункциях желудочно-кишечного тракта, а также дефицита протеина в рационе.

Превышение нормы встречается редко, но оно может указывать на хронические тяжелые инфекции (такие как туберкулез), ускоренный распад эритроцитов, системные опухоли или обезвоживание организма.

С-реактивный белок — фракция протеинов плазмы, которая повышается при наличии в организме воспалительного процесса. Синтезируется в ответ на попадание в кровь токсинов патологических микроорганизмов и обезвреживает их путем их связывания, а также запускает иммунные реакции. С-реактивный белок в норме отсутствует в крови (либо его показатели не превышают 0,4 мг/л). Большие значения указывают на развитие патологий: инфекционных и вирусных заболеваний, панкреатита, пиелонефрита, гепатита, язвенного колита и онкологии.

Помимо крови, белок учитывают в анализе мочи. Небольшое его количество встречается и у здоровых людей, в норме — до 140 мг/л (до 0,140 г/л). При активной физической нагрузке показатели не должны превышать 250 мг/сутки (0,250 г/л). Для того, что точнее узнать потери белка с мочой, необходимо проводить исследование его концентрации в суточных анализах. Их назначают при заболеваниях мочевыделительной системы и почек, инфекциях, а также для контроля осложнений, в том числе при приеме препаратов, оказывающих нефротоксическое действие — поражение почек.

Переизбыток белка

Высокое потребление белка может нанести вред людям с заболеваниями почек [26]. Двумя основными факторами риска почечной недостаточности являются высокое кровяное давление (гипертония) и диабет. И то, и другое провоцируется переизбытком белка [27] [28]. Точное количество необходимого протеина варьируется в зависимости от возраста, состояния здоровья и образа жизни. Исследование с участием здоровых мужчин, занимающихся силовыми тренировками, показало, что ежедневное употребление 3 г белка на кг массы тела в течение года не имело никаких неблагоприятных последствий для здоровья [29]. Даже 4,4 г на кг веса в течение двух месяцев не вызывало никаких побочных эффектов [30].

Нет никаких доказательств того, что потребление белка в разумных количествах причиняет вред здоровым людям. Напротив, существует множество доказанных преимуществ. Однако, если у вас заболевание почек, следует следовать советам врача и ограничить потребление протеинов.

Богатое белками, но бедное жирами и углеводами питание — нагрузка на почки и печень. Переизбыток белка на фоне нехватки других необходимых организму веществ выражается в проблемах с пищеварением, неприятном запахе изо рта и постоянной жажде.

Недостаток белка

Помимо показателей медицинских анализов есть и другие признаки недостатка протеина, которые вы можете заметить перед походом к врачу.

Постоянный голод

Белки насыщают и заряжают энергией надолго, но в качестве перекуса многие из нас используют не белковые продукты, а содержащие углеводы: бананы, печенье, конфеты, выпечку и бутерброды. Еда, богатая углеводами, приводит к быстрому подъему уровня сахара (и мы чувствуем себя сытыми) и такому же быстрому падению (через полчаса мы снова голодны). Этот же эффект вызывает тягу к сладкому: организму не хватает сил, а конфета — самый быстрый способ их получить. Правда, ненадолго.

Слабые волосы и ногти

Ногти и волосы — это тоже белок, а точнее, кератин. Для их здоровья регулярное потребление белковой пищи абсолютно необходимо, иначе организму неоткуда будет брать строительный материал. При дефиците белка волосы становятся тонкими, слабыми и тусклыми, плохо растут и секутся, а ногти начинают ломаться и расслаиваться.

Медленное заживление ран

Если даже маленькая царапина заживает дольше недели, это тоже может быть признаком недостатка белка. Он входит в состав клеток мышечной ткани, кожи и крови, поэтому, если макроэлемента не хватает, на ремонт повреждений у организма уходит гораздо больше времени.

Частые инфекционные болезни

По мнению доктора Алиссы Рамси из американской Академии питания и диетологии, белок также необходим для построения клеток иммунной системы — если вы едите мало белковых продуктов, со временем защита организма может ослабеть.

Без белка замедляется выработка интерферона и лизоцима, «защитников», отбивающих атаки патогенов. Иммунитет перестает справляться с бактериями и вирусами, и мы болеем чаще. Причем любыми инфекционными заболеваниями: у людей на низкобелковой диете часто диагностируют инфекции.

Отеки

Дефицит белка приводит к нарушению водно-солевого баланса, из-за чего жидкость скапливается в тканях. Результат — мешки под глазами и опухшее по утрам лицо, отеки лодыжек и стоп, чувство тяжести в ногах, которое появляется уже в середине дня, даже если вы носите удобную обувь.

Снижение веса

У нашего организма свои приоритеты. Если белка не хватает, то все поступающие протеины направляются туда, где они жизненно необходимы, то есть к внутренним органам. Мышцам при этом почти ничего не достается, и они начинают уменьшаться в объеме. Правда, снижение мышечной массы при белковой недостаточности заметить трудно — за счет отеков вес может оставаться относительно стабильным или снижаться очень медленно. Зато вы точно заметите другие признаки постепенной атрофии мышечной ткани — слабость и быструю утомляемость. Люди, желающие скорректировать вес, часто отказываются от жиров или белка, но это ошибка. Важно соблюдать баланс: основу правильной диеты составляют мясо, рыба (или продукты с высоким содержанием белка растительного происхождения), крупы и овощи.

Плохое настроение

Белок, помимо всего прочего, важен для синтеза нейромедиатора серотонина. Именно он отвечает за хорошее настроение и стрессоустойчивость. Недостаток серотонина приводит не только к хандре, плаксивости и мрачным мыслям, но и к бессоннице, повышенной тревожности, нервозности и склонности взрываться по пустякам.

Комментарии эксперта

Горбачёва Наталья Леонидовна, диабетолог, диетолог, эндокринолог, ведущий специалист сети клиник «Семейная»

«Правильный белковый обмен веществ — баланс между распадом и синтезом белков. Организму должно хватать аминокислот для построения новых соединений. Степень усвоения белка зависит от его происхождения и способа термической обработки. Элемент не способен накапливаться в организме, его излишки выводятся с помощью почек. Поэтому чрезмерное потребление белка негативно сказывается на их состоянии

Причинами нарушений белкового обмена могут стать наследственные заболевания: подагра, а также тяжелые состояния, такие как онкопатологии, следствие радиационного облучения и прочее. Но в большинстве случаев у взрослого человека симптомы нарушения биосинтеза белков говорят о несбалансированном рационе питания.

Недостаток белков — актуальная проблема. Одних она настигает при избавлении от лишнего веса, других — при вегетарианстве, а третьих — из-за заболеваний пищеварительной и эндокринной систем. Дефицит белков может не проявляться клинически, но последствия недостатка протеина довольно печальны:

  • задержка роста и развития у детей;
  • малая мышечная масса;
  • сердечно-сосудистые заболевания;
  • плохой аппетит;
  • вялость, апатия, усталость;
  • плохое состояние кожи, волос, ногтей.

Если биосинтез белков нарушен на этапе построения, человек может страдать от белкового отравления. Характерными признаками интоксикации являются поражение печени и почек, нарушения работы ЖКТ. Переизбыток белка влияет на центральную нервную систему вплоть до серьезных поражений при врожденных нарушениях обмена веществ. При ухудшении самочувствия необходимо сдать анализы и получить рекомендации специалиста.» 

450106, г.Уфа, ул. Ст. Кувыкина, 96. e-mail: [email protected]orrb.ru

Белок (часть 1)
⠀       Белки являются основным строительным материалом для организма, для работы мышц и иммунной системы. Белки входят в состав всех клеток организма человека и участвуют во всех этапах обмена веществ.
⠀Белки бывают животного и растительного  происхождения. В пищеварительном тракте белки при помощи ферментов расщепляются на аминокислоты, из которых потом организм строит «собственные» белки. Основных аминокислот двадцать две. Причем девять из них организм не может вырабатывать самостоятельно и получает их только с пищей.

⠀1 грамм белка обеспечивает организму 4 ккал.
⠀Усвояемость животных и растительных белков различна:
–  так на 98% усваиваются белки, содержащиеся в яйцах и молочных продуктах,
– на  90% — белки рыбы,
– на 70% — белки мяса и птицы,
– на 50% — белки зерновых,
– на 45% — белки бобовых и овощей.
Из-за низкой усвояемости растительных белков и отсутствия в них незаменимых аминокислот, люди, которые полностью отказываются от белков животного происхождения (мяса, рыбы, яиц, молочных продуктов), испытывают недостаток полноценных белков. ⠀Суточная норма потребления белка должна составлять для взрослого человека 1 грамм на 1 килограмм веса. Причем от 70 до 80% должны составлять белки животного происхождения.
Необходимо помнить о функции белков в организме, а они очень важны! В первую очередь это:
–  защитная функция– в ответ на проникновение в организм чужеродных белков или микроорганизмов образуются особые белки – антитела, способные связывать и обезвреживать их. Фибрин, образующийся из фибриногена, способствует остановке кровотечений;
– структурная (строительная) – коллаген придает упругость соединительной ткани;
– каталитическая– ферменты, они обладают специфическими каталитическими свойствами, то есть каждый фермент катализирует одну или несколько сходных реакций, например пепсин, расщепляет белки в процессе пищеварения. Известно около 4000 реакций, катализируемых белками;
– транспортная – гемоглобин переносит кислород и транспортирует его ко всем тканям и органам;
– регуляторная – инсулин регулирует уровень глюкозы в крови, гормон роста усиливает рост организма.
⠀⠀Присутствуют ли в вашем рационе белки, какие? Делитесь в комментариях.

Главный врач                                                                                  Николаева И.Е.

Заместитель главного врача по мед.части                                  Ермолаев Е.Н.

Заместитель главного врача по ОМР                                           Камалова В.Р.

Избыточное потребление белка приводит к подагре, определить суточную норму в Москве

Сколько белка нужно человеку?

На этот вопрос нет ответа, одинакового для всех. Потребность в белке возрастает при интенсивном росте (у детей), во время беременности, при некоторых патологических состояниях (ожогах, заболеваниях легких). При отдельных заболеваниях белок следует ограничивать, так как у организма снижены возможности полной утилизации продуктов его распада, в первую очередь — аммиака (мочевины).

Зачем нужен белок?

Любой белок — это комбинация двадцати аминокислот. Мы употребляем в пищу растительные или животные белки только для того, чтобы наш организм смог построить из них собственные. При пищеварении белки расщепляются на аминокислоты. И эти аминокислоты используются для построения клеток, синтеза гормонов и многих других важных веществ, без которых жизнь человека становится невозможной.

К чему приводит избыточное потребление белка?

В организме белок разлагается на воду, аммиак и глюкозу. Глюкоза — источник энергии, вода полезна, а аммиак — яд. Поэтому в печени связывается особыми ферментами и превращается в мочевину. Мочевина выводится почками. Если поступление белка значительно превышает норму, железы внутренней секреции работают с большим напряжением, повышается нервная возбудимость, страдают печень, почки, суставы, нарушается обмен веществ.

Обычно с избыточным потреблением белка связывают два заболевания: мочекаменную болезнь и подагру. Однако они вызваны нарушением другого вещества — мочевой кислоты, которая накапливается в организме в результате нарушения пуринового обмена. Ошибка простительна. Она объясняется тем, что и белок, и пурины в большом количестве содержатся в мясе и рыбе. То есть, употребляя без меры мясо (особенно мясные деликатесы!), человек получает не только белки, но и пурины.

Мочекаменная болезнь почек

Соли мочевой кислоты кристаллизуются в канальцах почек. В результате образуются камни, которые затрудняют отток мочи. Пока конкременты маленькие, человек ощущает незначительный дискомфорт в области поясницы. По мере их роста дискомфорт усиливается. В случае, когда камень перекрывает проток возникает почечная колика. Её симптомы резко выражены:

  • резкая боль в пояснице;
  • человек мечется, меняя положение тела в поисках позы, в которой боль станет хоть чуть меньше.

Это состояние требует неотложных мер. Нужно вызвать бригаду скорой помощи и следовать указаниям доктора.

Подагра

Хроническое обменное заболевание, которое развивается при поражении почек или чрезмерной выработке пуринов. Мочевая кислота накапливается — появляется подагра.

Характерные признаки:

  • артрит, чаще поражаются мелкие суставы;
  • асимметрия поражений;
  • острые приступы сменяются ремиссиями.

Лечение подагры проводится в стационаре. Проводится медикаментозная терапия, подбирается диета.

Диета при подагре, мочекаменной болезни

Обычно рекомендуется шестой диетический стол, ограничивающий употребление мяса и соли. Исключаются мясные деликатесы, субпродукты, бобовые, щавель, шпинат, крепкие бульоны.

Рекомендуется увеличить в рационе долю растительного белка, усилить питьевой режим.

Определение суточной нормы белка в Москве

В клинике MAJOR CLINIC ведет прием опытный диетолог высокой квалификации. Вы можете сделать своё питание правильным и полезным, записавшись на консультацию к доктору. После изучения ваших особенностей обмена и двигательной активности, врач составит для вас индивидуальный рацион и примерное меню. Придерживаясь рационального питания, вы очень скоро почувствуете себя значительно лучше. Ощутите прилив энергии, станете более активным и жизнерадостным человеком.

7 видов питательных веществ. Какое важнее?

     Углеводы, жиры, белки, витамины, минералы, клетчатка и вода — 7 главных компонентов пищи. Каждый из компонентов выполняет специфические функции и принимает участие в регуляции физиологических процессов, поэтому все они необходимы для нормального функционирования организма.

     Углеводы, являясь основным источником энергии, обеспечивают организм теплом и топливом для работы. Белки предоставляют строительный материал для  роста и восстановления всех клеток и тканей. Жиры —  резервный аккумулятор энергии на «черный день», источник важных компонентов для регуляции обмена веществ, в том числе и гормонального обмена. Клетчатка выполняет функцию пылесоса, помогая организму очищаться от токсинов, а также поддерживает нормальную микрофлору кишечника. Витамины и минералы, взаимодействуя между собой, обеспечивают большинство биохимических реакций. Вода как универсальный растворитель является важнейшим регулятором обмена веществ и обеспечивает работу всех функций организма.

     В разных категориях пищи преобладают разные питательные вещества. Например, мясо — превосходный источник белка, в то время как зёрна богаты углеводами, а овощи и фрукты содержат много витаминов и клетчатки.

     Не существует одного наиболее важного питательного вещества. Все они имеют равную ценность, и их соотношение в рационе должно быть сбалансированно. Дефицит хотя бы одного из нутриентов чреват проблемами со здоровьем. Например, если продолжительное время вы испытываете слабость, снижение концентрации внимания, перепады настроения, утомляемость — вероятно в вашем рационе недостаточно углеводов. Дефицит белка может привести к снижению иммунитета, анемии, мышечной слабости и истощению. Недостаток полезных жиров может привести  к нарушению гормонального фона, сухости и шелушению кожи. Дефицит клетчатки приводит к нарушению работы кишечника и дисбактериозу. А водный дисбаланс грозит интоксикацией и нарушением метаболизма.

     Несмотря на то, что перечисленные вещества необходимы каждому человеку, их оптимальное соотношение всегда индивидуально. Факторами, влияющими на потребность нутриентов, являются генетика, возраст, вес, уровень активности, образ жизни, пол и состояние здоровья. Например, для здорового мужчины 35 лет с весом 85 кг, работающего в офисе и 2 раза в неделю посещающего спортзал, потребность в  нутриентах следующая:

Диапазон калорий: 2400-2650 ккал

Норма белка: 200-210 г

Норма жиров: 67-70 г

Норма углеводов: 270-320 г

     Очень важно знать, каковы именно ваши индивидуальные потребности. Это основа правильного питания и первый шаг к здоровому образу жизни. Чтобы узнать, какое количество питательных веществ необходимо вам и какое их соотношение будет правильным, лучше всего  обратиться к специалисту диетологу или нутрициологу. Или воспользоваться приложением умного браслета ONETRAK Sport, которое не только рассчитает вашу дневную норму, но и поможет ее соблюдать.

     Баланс, умеренность и разнообразие – главные характеристики здорового питания. От этого зависит ваше самочувствие, здоровье, внешние изменения, спортивные достижения и даже настроение.

 

Белковая субстанция — Ответы на кроссворды

Кроссворд Белковая субстанция из 6 букв в последний раз видели , 27 февраля 2018 г. . Мы думаем, что вероятным ответом на эту подсказку будет ENZYME . Ниже приведены все возможные ответы на эту подсказку, отсортированные по ее рангу. Вы можете легко улучшить свой поиск, указав количество букв в ответе.
Рейтинг Слово Подсказка
94% ФЕРМЕНТ Белковое вещество
3% ГЛЮТЕН Вещество в пшенице
3% СОЯ Бобовый протеин
3% МЯСО Вещество
3% КИНОА Зерновые, богатые белком
3% КЛЕЙ Клейкое вещество
3% РОСИН Сущность виолончелиста
3% ГАЙКА Хрустящий источник белка
3% ТАЙНА Неидентифицируемый белок
3% ЩЕЛОЧКА Коррозионное вещество
3% КРАСИТЕЛЬ Красящее вещество
3% КОРАЛЛ Рифовое вещество
3% ТОФУ Обычный веганский протеин
3% AMINO Протеиновая кислота
3% СЛАЙМ Слизистая субстанция
3% ДЕЛО Вещество
3% АНЕСТЕТИЧЕСКИЙ Онемение вещества
3% СОИ Белок тофурки
3% ЯД Смертоносное вещество
3% РНК Вещество, продуцирующее белок

Уточните результаты поиска, указав количество букв.Если определенные буквы уже известны, вы можете указать их в виде шаблона: «CA ????».

Мы нашли 1 решение для белковой субстанции . Лучшие решения определяются по популярности, рейтингам и частоте запросов. Наиболее вероятный ответ на разгадку — ENZYME .

С crossword-solver.io вы найдете 1 решение. Мы используем исторические головоломки, чтобы найти лучшее, что соответствует вашему вопросу.Мы добавляем много новых подсказок ежедневно.

С нашей поисковой системой для решения кроссвордов у вас есть доступ к более чем 7 миллионам подсказок. Вы можете сузить круг возможных ответов, указав количество содержащихся в нем букв. Мы нашли более 1 ответов для Protein Substance.

белков и тело | Государственный университет Оклахомы

Опубликовано апр.2021 г. | Id: T-3163

От Дженис Р.Германн

Белок является питательным веществом

Белок — это питательное вещество, необходимое организму для роста и поддержания себя. Рядом с водой, белок — самое многочисленное вещество в нашем организме. Почти все это знают мышцы состоят из белка. На самом деле в каждой клетке тела есть белок. Кроме того, другие важные части тела, такие как волосы, кожа, глаза и органы тела все сделаны из белка.

Многие вещества, контролирующие функции организма, такие как ферменты и гормоны, также являются сделан из протеина. Другие важные функции белка включают формирование клеток крови. и создание антител для защиты от болезней и инфекций.

Аминокислоты

Белки состоят из более простых веществ, называемых аминокислотами.Есть 20 аминокислот в белке, который мы едим каждый день. Организм берет эти аминокислоты и связывает их вместе в очень длинные струны. Вот как организм вырабатывает различные белки. он должен функционировать должным образом. Девять из аминокислот называются незаменимыми , потому что организм не может их вырабатывать. Эти незаменимые аминокислоты должны поступать из продуктов. мы едим.

На рисунке 1 показана диаграмма гормона инсулина, регулирующего уровень глюкозы (сахара) в крови.Инсулин — это очень маленький белок. Многие белки состоят из тысяч аминокислот. нанизаны вместе. Буквы в кружках — это аббревиатуры аминокислоты. это в том месте. Белки могут быть очень сложными из-за всех комбинаций аминокислот, составляющих цепи.

Продукты, содержащие белок

Как растительная, так и животная пища содержат белок.Продукты, обеспечивающие все необходимое аминокислоты называются высококачественными белками. Продукты животного происхождения, такие как мясо, рыба, птица, яйца и молочные продукты, — это все источники высококачественного белка. Это продукты, о которых люди обычно думают, когда хочу съесть белок. Незаменимые аминокислоты в продуктах животного происхождения находятся в нужном месте остаток средств.

Продукты, которые не обеспечивают хороший баланс всех незаменимых аминокислот, называются белка более низкого качества, белка.Растительные продукты содержат белки более низкого качества. Большинство фруктов и овощей плохие источники белка. Другие растительные продукты, такие как запеченная фасоль, колотый горох и чечевица, арахис и другие орехи, семена и зерна, такие как пшеница, являются лучшими источниками. Они вносят свой вклад много белка. Однако в каждом типе растительного белка мало одного или больше незаменимых аминокислот. Это делает их белком более низкого качества.Животное белки содержат лучший баланс незаменимых аминокислот, чем растительные белки.

Людям, не употребляющим продукты животного происхождения, следует вместе есть разные виды растительной пищи. или в тот же день, чтобы получить правильный баланс и количество незаменимых аминокислот их тела нужны. Сочетание бобов и риса, или бобов и кукурузы, или арахисового масла и хлеб содержит все незаменимые аминокислоты в нужном количестве.Эта еда комбинации смешивают продукты из разных групп растений, чтобы дополнить предоставленные аминокислоты каждым.

Комбинирование продуктов любых двух из следующих групп растений даст более высокое качество белок:

  • Бобовые , такие как сушеные бобы, горох, арахис, чечевица и соя
  • Зерновые , такие как пшеница, рожь, рис, кукуруза, овес и ячмень
  • Семена и орехи , такие как семена подсолнечника и тыквы, орехи пекан и грецкие орехи

Сочетание небольшого количества животного белка с большим количеством растительного продукта может также удовлетворить потребности человека в белке.Таким образом, комбинируя небольшое количество любого из следующих продукты животного происхождения с любой из перечисленных выше групп растений будут иметь более высокое качество белок.

  • Яйца
  • Молочные продукты , такие как молоко, сыр и йогурт
  • Мясо , такое как говядина, птица, рыба, баранина и свинина

Рисунок 1 .Аминокислоты в белке инсулина.

Другие способы использования белка

Три основных питательных вещества обеспечивают калории: белок, углеводы и жиры. Каждый грамм белка и углеводов обеспечивает 4 калории.Лучшее использование протеина — восстановление и поддерживать ткани тела. Если люди едят больше белка, чем нужно для поддержания тканей и ремонтировать, их тела используют это для энергии. Если он не нужен для энергии, их тела используют дополнительный белок для производства жира. Затем он становится частью жировых клеток. Если люди не едят достаточно калорий, белок в пище и в своем организме будет использоваться для получения энергии. В этом случае белок не используется по своему основному назначению, а именно для поддержания тело.Получение достаточного количества белка и сбалансированное питание с достаточным количеством калорий являются важный. Таким образом, белок будет использоваться для тканей и других функций белка. Жиры и углеводы будут использоваться для удовлетворения энергетических потребностей.

Потребность в белке

Белок нужно есть каждому человеку.Сколько белка ему нужно, зависит от его или ее размер тела и особые потребности, такие как рост. Детям нужно больше белка на фунт веса тела, чем у взрослых, потому что они растут и строят новую белковую ткань. Беременным и кормящим женщинам требуется больше белка для роста ребенка и его производства. молоко. Норма потребления с пищей (DRI) говорит нам о среднем количестве белка. человеку нужен каждый день.Рассчитайте потребность в белке по формуле 0,8 грамма. белка на каждый килограмм массы тела. Чтобы найти вес в килограммах, разделите вес в фунтах на 2,2.

Пример :

Вес человека = 165 фунтов

165 фунтов / 2.2 фунта
за килограмм

75 кг X 0,8 грамма
за килограмм

Этому человеку требуется 60 граммов белка в день.


Другой простой сокращенный подход — умножить массу тела в фунтах на 0.4. Это это приблизительная оценка, требующая меньшего количества вычислений.

Пример :
165 фунтов X 0,4 = 66 граммов в день.

Важно помнить, что дополнительный белок не дает особой пользы. Люди не хранят дополнительный диетический белок в виде мускулов тела. Дополнительный белок сверх ежедневная потребность не приведет к увеличению мышечной массы, быстрому росту волос и не защитит от болезни. Белок сверх необходимого расщепляется и используется для получения энергии, или он превращается в жир и хранится в жировых клетках. Слишком мало белка приведет к постепенное разрушение белковых тканей организма и потеря мышечной ткани.Тело будет не смогут нормально функционировать в этих условиях.

Лучший способ удовлетворить потребность в белке — съесть рекомендуемое количество пищи из каждого продукта. групп продуктов питания MyPlate Plan USDA. Рекомендуемые суммы для каждого плана USDA MyPlate Группа продуктов питания каждый день для контрольной диеты на 2000 калорий:

  • 6 унций.зерен
  • 21/2 чашки овощей
  • 2 чашки фруктов
  • 3 стакана молочных продуктов
  • 5 1/2 унций. белковой пищи
  • 6 чайных ложек масла

В таблице 1 показано содержание белков и жиров в различных распространенных пищевых продуктах.

Чтобы получить необходимый белок без излишка жиров или насыщенных жиров, выбирайте нежирные продукты. мяса и нежирной рыбы и снимите кожу с птицы. Вареные зерна и фасоль, горох и чечевица с низким содержанием жира, если вы не добавляете жир при приготовлении, и она недорогая. источники белка. Орехи и арахисовое масло являются хорошими источниками белка, но они также с высоким содержанием жира.Яйца также являются недорогим источником белка. Выбирайте обезжиренные молочные продукты продукты часто и не добавляют жира при приготовлении или подаче этих продуктов.

Наблюдая за источниками белка и соблюдая диету в соответствии с планом MyPlate USDA, люди могут быть уверены, что получают достаточно белка для удовлетворения своих потребностей без лишний жир, который им не нужен.

Таблица 1. Белок в обычных продуктах питания, граммы на порцию

Размер еды и порции Белок жир
Курица, легкое мясо, без кожи, 3 унции, приготовленная 26.3 3,0
Жаркое из свинины, 3 унции, приготовленное 23,9 8,9
Курица, темное мясо, 3 унции, приготовленная 23,3 9,3
Говядина, стейк, 3 унции, приготовленная 22.6 4,9
Сыр Чеддер, 3 унции 21,1 28,2
Творог обезжиренный 1/2 стакана 15.6 2,2
Молоко обезжиренное, 1 стакан 8,4 0,4
Яйцо, 1 целое 6,3 5,3
Арахисовое масло 2 столовые ложки 7.9 16,0
Запеченная фасоль, 1/2 стакана 6,6 1,3
Семечки подсолнечника 1/4 стакана 6,2 15,9
Пекан, 1/4 стакана 2.3 20,2
Овсянка, 3/4 стакана 4,6 1,8
Рис 1/2 стакана 2.8 0,3
Цельнозерновой хлеб, 1 ломтик 2,6 1,5
Хлеб белый, 1 слайд 2,5 0,9
Яблоко, 1 целое 0.3 0,5
Зеленая фасоль, 1/2 стакана 0,9 0,1
Брокколи, 1/2 стакана 2,3 0,1

Список литературы

Уитни, Э.Н. и Рольфес, С. (2015) Понимание питания , 14-е изд. Wadsworth Cengage Learning, Белмонт, Калифорния.

Министерство сельского хозяйства США. Выберите MyPlate.gov. Доступно по адресу: www.choosemyplate.gov

.

Дженис Р. Херманн, доктор философии, RD / LD

Специалист по питанию

Была ли эта информация полезной?
ДА НЕТ Гидратация и спортсмены

Эштон Грир; Джилл Джойс, доктор философии, доктор медицинских наук; Jenni Klufa, MS, RD, LD; Кеннеди Кролл; и Гена Волленберг, PhD, RD, CSSD, LD.Узнайте, как оставаться гидратированным во время упражнений.

УпражненияЗдоровье, питание и хорошее самочувствиеПитание ПОСМОТРЕТЬ ВСЕ

Рекомбинантный белковый антиген препротахикинина-1 (NBP1-82555PEP): Novus Biologicals

Резюме рекомбинантного белкового антигена препротахикинина-1

Описание Рекомбинантный белковый антиген с N-концевой меткой His6-ABP, соответствующей человеческому препротахикинину-1.

Источник: E.coli

Аминокислотная последовательность: WSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFAM

Источник

E. coli

Тип белка / пептида

Рекомбинантный белковый антиген

Джин

ТАС1

Чистота

> 80% по данным SDS-PAGE и окрашиванию кумасси синим

Применения / разбавления

Разведения
  • Конкуренция антител 10-100 молярный избыток
Примечания по применению Этот пептид полезен в качестве пептида, блокирующего NBP1-82555.Белок очищали хроматографией на IMAC. Ожидаемая концентрация больше 0,5 мг / мл. Этот товар производится по запросу, ориентировочная дата доставки — 4 недели после размещения заказа. Для получения дополнительной информации о блокировке пептидов и протокола щелкните здесь.
Теоретическая молекулярная масса

29 кДа.
Примечание об отказе от ответственности: наблюдаемая молекулярная масса белка может отличаться от указанной в списке прогнозируемой молекулярной массы из-за посттрансляционных модификаций, посттрансляционных расщеплений, относительных зарядов и других экспериментальных факторов.

Упаковка, хранение и составы

Хранение

Хранить при -20 ° C. Избегайте циклов замораживания-оттаивания.

Буфер

PBS и 1M мочевина, pH 7,4.

Консервант

Без консерванта

Чистота

> 80% по данным SDS-PAGE и окрашиванию кумасси синим

Банкноты

Этот продукт предназначен для использования в качестве блокирующего антигена в анализах конкуренции антител.Любое другое использование этого антигена связано с риском для пользователя. Использование этого продукта в коммерческих целях строго запрещено. Если у вас возникнут вопросы, обратитесь в службу технической поддержки.

Альтернативные названия для рекомбинантного белкового антигена препротахикинина-1

  • Hs.2563
  • NK2
  • NKNA
  • NPK
  • PPT
  • протахикинин-1
  • TAC1
  • TAC2

Фон

Этот ген кодирует четыре продукта семейства гормонов тахикининового пептида, вещество P и нейрокинин A, а также родственные пептиды, нейропептид K и нейропептид гамма.Считается, что эти гормоны действуют как нейротрансмиттеры, которые взаимодействуют с нервными рецепторами и гладкомышечными клетками. Известно, что они вызывают поведенческие реакции и действуют как сосудорасширяющие и секретагогические средства. Вещество P — антимикробный пептид с антибактериальными и противогрибковыми свойствами. Для этого гена обнаружено множество вариантов транскриптов, кодирующих разные изоформы.

Ограничения

Этот продукт предназначен только для исследовательского использования и не одобрен для использования на людях или для клинической диагностики.Гарантия на пептиды и белки составляет 3 месяца с даты получения.

Покупатели, которые просматривали этот товар, также просматривали …

Виды: Hu

Применения: IHC, WB

Виды: Bv, Hu, Po, Rt

Применения: ELISA, ICC / IF, IHC, IHC-P, WB

Виды: Hu, Rt

Приложения: ICC / IF, IHC, S-ELISA, WB

Виды: Hu, Mu, Rb, Rt, Xp, Ze

Применения: ICC / IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB

Виды: Hu

Приложения: CyTOF-ready, Flow, IHC, Simple Western, WB

Виды: Hu

Приложения: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB

Виды: Hu, Mu, Rt

Применения: ICC / IF, IHC, IHC-P

Виды: Hu, Mu, Rt

Применения: ICC / IF, IHC, IHC-Fr, IHC-P, WB

Виды: Mu

Приложения: CyTOF-ready, Flow, ICC

Виды: Hu

Применения: IHC, IHC-P, WB

Виды: Hu

Применения: IHC, IHC-P

Виды: Hu, Mu, Rt

Применения: ICC / IF, IHC, IHC-Fr, IHC-P, WB

Виды: Hu

Применения: IHC, IHC-P

Виды: Hu, Mu, Po, Rt, Sh

Применения: Flow, ICC / IF, IHC, IHC-P, PEP-ELISA, WB

Виды: Hu

Применения: ELISA

Виды: Hu, Mu, Rt

Применения: Flow, ICC / IF, IHC, IHC-Fr, IHC-P, WB

Виды: Hu, Mu, Rt

Применения: Flow, ICC / IF, IHC, IHC-P, WB

Виды: Dr, Hu, I, Ma, Mu, Rt

Применения: Dual ISH-IHC, ICC / IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO , Простой вестерн, WB

Публикации для рекомбинантного белкового антигена препротахикинина-1 (NBP1-82555PEP) (0)

Нет публикаций по рекомбинантному белковому антигену препротахикинина-1 (NBP1-82555PEP).

Отправляя информацию о публикации, зарабатывайте подарочные карты и скидки для будущих покупок.

Обзоры на рекомбинантный белковый антиген препротахикинина-1 (NBP1-82555PEP) (0)

Нет обзоров для Препротахикинин-1-рекомбинантный белковый антиген (NBP1-82555PEP). Отправив отзыв, вы получите электронную подарочную карту Amazon или скидку на продукцию Novus.
  • Обзор без изображения — 10 долларов / 7 евро / 6 фунтов стерлингов / 10 канадских долларов / 70 юаней / 1110 иен
  • Обзор с изображением — 25 долларов / 18 евро / 15 фунтов стерлингов / 25 канадских долларов / 150 юаней / 2500 иен

Часто задаваемые вопросы по рекомбинантному белковому антигену препротахикинина-1 (NBP1-82555PEP) (0)

Другие доступные форматы

Дополнительные продукты препротахикинина-1

Инструмент биоинформатики для рекомбинантного белкового антигена препротахикинина-1 (NBP1-82555PEP)

Откройте для себя пути, заболевания и гены рекомбинантного белкового антигена препротахикинина-1 (NBP1-82555PEP).Нужна помощь? Прочтите Руководство по использованию инструмента биоинформатики для получения инструкций по использованию этого инструмента.

Блоги о Препротахикинине-1

Что такого хорошего в Protein


11 мая 2018 г. (пт)

Почему мы связываем углеводы с энергией, а избыток жира приравниваем к потенциальной сердечной недостаточности? болезнь и достаточное количество белка в рационе при удовлетворительном уровне жизни?

Белок полезен и необходим для жизни.Возможно, именно это имел в виду Герберт Гувер. в 1928 году, когда он пообещал «по цыпленку в каждом горшке» (1). Теперь мы знаем, что есть много хороших альтернативные источники белка, такие как соя, в дополнение к молоку, яйцам и мясу, но смысл не потеряно.

Что делают белки?

Белок, который мы потребляем, играет как структурную, так и физиологическую роль. Это источник амино кислоты, которые служат строительным материалом не только для тканей тела, но и для различных вещества и сущности, которые помогают поддерживать гомеостаз и позволяют нам развиваться физически и эмоционально.Я имею в виду мРНК, ДНК, ферменты, антитела, поддержание нашей кислотной основы. баланс и рост в целом. Наше тело просто не функционировало бы без белков.

Почему белок так важен? Есть несколько причин. Белки, созданные в нашем организме, несут из множества функций, которые нам необходимы, чтобы оставаться здоровыми и даже выжить. Рост тканей тело, такое как мышцы, сухожилия, кости и органы, начиная с клеточного уровня, требует адекватного запас протеина.Наша скелетная система в значительной степени состоит из белкового вещества, называемого коллаген, который влияет на связки, сухожилия, мышцы, кожу, зубы и ногти. (8).

Гормоны — это по большей части белковые вещества, вырабатываемые клеткой или железой в одной части тело, которое отправляет сообщения, влияющие на клетки в других частях организма. Гормоны имеют регулирующая функция. Они выделяются такими органами, как поджелудочная железа, гипофиз, паращитовидная железа. железы, сердце, желудок, печень и почки.

Гормоны поддерживают гомеостаз или баланс тела (8). Они способствуют росту и развитие и опосредование реакций нервной системы. Инсулин регулирует уровень в крови глюкоза и вещество Р — это белок, который опосредует болевые ощущения. Когда человек слишком мало или слишком много определенного гормона, это потенциально может привести к медицинским такие проблемы, как сахарный диабет.

Белки способствуют образованию ферментов, которые являются катализаторами химических реакций в организме. тело, без которого мы не смогли бы выжить.Амилаза, липаза и лактаза слюны являются белками. которые играют важную роль в усвоении питательных веществ из пищи, которую мы принимаем.

В крови обнаружено 13 белков свертывания крови (факторов свертывания крови). Они есть обозначается римскими цифрами от I до XIII. Отсутствие одного фактора влияет на свертываемость крови. (8).

Антитела — это белковые вещества, которые защищают наш организм от вирусов и бактерий. Если нам не хватает белка, достаточного для производства этих антител, наш иммунологический ответ слабый, и мы более восприимчивы к болезням (8).

Белки также выполняют в организме «сократительную» функцию, так что мы можем двигаться. Актин и миозин — это белки, отвечающие за сокращение мышц.

Наша способность поддерживать надлежащий кислотно-щелочной баланс в нашем организме обусловлена ​​«буферным эффектом» белка (8). PH артериальной крови должен быть 7,4. Если жидкости нашего тела становятся слишком кислыми (низкий pH) или слишком щелочной (высокий pH) эта ситуация может привести к изменению формы белков и они становятся «денатурированными» и не могут нормально функционировать.Химическая структура белков объединяет кислотную или карбоксильную группу (COOH) с основанием (амином), и это позволяет белкам действуют как кислота или основание в зависимости от среды, в которой они находятся.

Белки выполняют очень важную транспортную функцию. Гемоглобин — это белок в крови. который транспортирует кислород по всему телу и, таким образом, позволяет клеткам нормально функционировать. А дефицит гемоглобина приводит к анемии, которая вызывает непереносимость физических упражнений и утомляемость.Один раз гемоглобин достигает мышц, он хранится в другом белке, называемом миоглобином (8).

Как работают белки?

Белки — это соединения, которые образуются путем соединения аминокислот в цепочечные структуры. называемые пептидами. Одна аминокислота соединяется со второй; третий затем добавляется к первым двум и так на. Связи между аминокислотами называются пептидными связями. Затем пептиды соединяются вместе. в более длинные полипептидные цепи.Отдельный белок может иметь одну или несколько полипептидных цепей. которые образуют его структуру.

Количество, последовательность и ассортимент комбинаций аминокислот позволяют практически неограниченное количество различных белковых структур. Два белка на самом деле могут содержать те же самые аминокислоты, но имеют разные функции, потому что они находятся в разной последовательности в пептидной цепи (7).

Аминокислоты отличаются от таких соединений, как глюкоза, тем, что они дополнительно содержат азот. на углерод, водород и кислород.Всего 20 аминокислот. 11 из них называются «Несущественные», потому что организм может производить их в печени. Остальные 9 — «незаменимые аминокислоты». кислоты », потому что мы должны получать их из пищи и добавок, которые мы едим. Это делает их более критический. Источником «полноценного протеина» считается тот, который содержит все необходимое и второстепенное. аминокислоты. Казеин, сыворотка и соя — все это полноценные источники белка.

Полный белок — это белок, который содержит все девять незаменимых аминокислот в количестве, равном достаточно, чтобы поддерживать рост и поддержание нашего тела.Яйца, молоко, говядина и птица — все это примеры полных белков. Соевые бобы и киноа (9) — два растительных источника полноценного белок. Есть еще.

Неполным белкам не хватает одной или нескольких из девяти незаменимых аминокислот. Злаки, бобовые и зерна являются примерами неполных белков. Есть возможность совмещать питание из двух неполных источники белка для получения полноценного белка. Именно по этой причине вегетарианцы могут получать полноценный белок в их рационе.

Что вызывает белковая недостаточность?

Лица в слаборазвитых странах, которые не имеют достаточного количества протеина для у населения есть такие болезни, как маразм и квашиоркор. Признаки и симптомы белка дефицит много. Они могут включать выпадение волос, вялость и слабость, кожные высыпания, вес. потеря, проблемы с засыпанием, замедленное заживление ран, инфекции, мышечные спазмы, ломкость ногтей, гребни на ногтях пальцев рук и ног, кожные язвы, головная боль, тошнота, отеки (задержка воды в ногах, ступнях, руки и т. д.), перепады настроения, депрессия, задержка роста и беспокойство (2). Эта болезнь явно демонстрирует, что дефицит белков приводит к обширному нарушению важнейших биологических функций.

Сколько протеина мне нужно?

Рекомендуемая суточная норма потребления белка составляет 0,8 г / кг / (или 2,2 фунта) (3). Этот доставляет примерно от 58 до 63 граммов в день для среднего взрослого мужчины. Диетический белок имеет решающее значение для развития и восстановления костей и мышц.Вот почему вы так много видите продажа в спортзалах. Некоторые исследования рекомендовали спортсменам, занимающимся выносливостью или Для силовых тренировок используется показатель от 1,2 до 1,7 г / кг (4), и многие гериатры предполагают, что увеличение количества диетического белка сверх текущего (RDA) может помочь сохранить костную и мышечную массу в пожилые люди (5, 6).

Из того, что мы узнали выше, легко понять, почему качественные белковые добавки важный шаг в разработке нескольких продуктов, от перекусов и восстановления мышц продукты в заменители еды.Положительное влияние протеина на чувство сытости, восстановление и рост мышц, и здоровье в целом трудно переоценить.

Список литературы

1. Рекламная кампания Республиканской партии. Нью-Йорк Уорлд, 30 октября 1928 года.

2. Beers MH, Berkow R, eds. Расстройства питания: недоедание. В: Руководство Merck. 17-е изд. Мерк; 1999: 28-32.

3. Оттен Дж. Дж. И др., Редакторы: Dietary DRI Ссылки: Основное руководство по питательным веществам. Требования, Вашингтон, округ Колумбия, 2006, The National Academies Press.

4. Позиционный документ Американской диетической ассоциации, диетологов Канады и Американский колледж спортивной медицины: питание и спортивные результаты, J Am Diet Assoc 109: 509-527, 2009.

5. Маркус Р: Старение скелета. В Чернофф Р. (ред.): «Гериатрическое питание: здоровье. Справочник профессионала », 2-е изд. Гейтерсбург, Мэриленд: Aspen Publishers, стр. 304– 319,1999.

6. Гафни-Стромберг Э. и др., J Am Geriatr Soc. 2009 июн; 57 (6): 1073-9.doi: 10.1111 / j.1532-5415.2009.02285.x. Epub 2009 30 апреля.

7. Бранден К., Туз Дж. (1999). Введение в структуру белка. Нью-Йорк: Garland Pub. ISBN 0-8153-2305-0.

8. Гайтон, Артур К., Учебник медицинской физиологии, девятое изд., 1996.

9. Университет Пердью. «Руководство по альтернативным полевым культурам — квиноа». http://www.hort.purdue.edu/newcrop/afcm/quinoa.html.


Глава 3. Белки и аминокислоты

Глава 3.Белки и аминокислоты



1. БЕЛКИ
2. ПИЩЕВАРЕНИЕ БЕЛКОВ И МЕТАБОЛИЗМ
3. ОБЩИЕ ТРЕБОВАНИЯ К БЕЛКАМ
4. АМИНОКИСЛОТЫ
5. КОЛИЧЕСТВО ТРЕБОВАНИЯ К АМИНОКИСЛОТЕ
6. ДОБАВКА ДИЕТЫ С АМИНОКИСЛОТАМИ
7. СПРАВОЧНАЯ ИНФОРМАЦИЯ


J. E. Halver
Вашингтонский университет
Сиэтл, Вашингтон

1.1 Классификация
1.2 Структура
1.3 Свойства
1.4 Химическое определение


Белки представляют собой сложные органические соединения, состоящие из многих аминокислот, связанных вместе пептидными связями и поперечно связанных между цепями сульфгидрильными связями, водородными связями и силами Ван-дер-Ваальса. Химический состав белков больше, чем у любой другой группы биологически активных соединений. Белки в различных клетках животных и растений придают этим тканям их биологическую специфичность.

1.1 Классификация

Белки можно классифицировать как:

(а) Простые белки. При гидролизе они дают только аминокислоты и иногда небольшие углеводные соединения. Примеры: альбумины, глобулины, глютелины, альбуминоиды, гистоны и протамины.

(b) Конъюгированные белки. Это простые белки в сочетании с небелковым материалом в организме. Примеры: нуклеопротеины, гликопротеины, фосфопротеины, гемоглобины и лецитопротеины.

(c) Производные белки. Это белки, полученные из простых или конъюгированных белков физическими или химическими способами. Примеры: денатурированные белки и пептиды.

1,2 Структура

Потенциальная конфигурация белковых молекул настолько сложна, что многие типы белковых молекул могут быть сконструированы и обнаружены в биологических материалах с различными физическими характеристиками. Глобулярные белки обнаруживаются в крови и тканевых жидкостях в аморфной глобулярной форме с очень тонкими или отсутствующими мембранами.Коллагеновые белки находятся в соединительной ткани, такой как кожа или клеточные мембраны. Волокнистые белки содержатся в волосах, мышцах и соединительной ткани. Кристаллические белки представлены хрусталиком глаза и подобными тканями. Ферменты — это белки со специфическими химическими функциями, которые опосредуют большинство физиологических процессов жизни. Несколько небольших полипептидов действуют как гормоны в тканевых системах, контролируя различные химические или физиологические процессы. Мышечный белок состоит из нескольких форм полипептидов, которые позволяют мышцам сокращаться и расслабляться при физических движениях.

1.3 Недвижимость

Белки также можно охарактеризовать по их химическим реакциям. Большинство белков растворимы в воде, спирте, разбавленной основе или в различных концентрациях солевых растворов. Белки имеют характерную спиралевидную структуру, которая определяется последовательностью аминокислот в первичной полипептидной цепи и стереоконфигурацией радикальных групп, присоединенных к альфа-углероду каждой аминокислоты. Белки термолабильны, проявляя различную степень лабильности в зависимости от типа белка, раствора и температурного профиля.Белки могут быть обратимыми или необратимыми, денатурированными при нагревании, концентрации соли, замораживании, ультразвуковом воздействии или старении. Белки претерпевают характерное связывание с другими белками в так называемой пластеиновой реакции и соединяются со свободными альдегидными и гидроксильными группами углеводов с образованием соединений типа Майяра.

1.4 Химическое определение

Содержание азота в большинстве белков, обнаруженных в тканях животных, орехов и зерна, составляет около 16 процентов; поэтому содержание белка обычно выражается как содержание азота × 6.25.

Проглоченные белки сначала расщепляются на более мелкие фрагменты пепсином в желудке или трипсином или химотрипсином из поджелудочной железы. Эти пептиды затем дополнительно восстанавливаются под действием карбоксипептидазы, которая гидролизует одну аминокислоту за раз, начиная со свободного карбоксильного конца молекулы, или с помощью аминопептидазы, которая отщепляет одну аминокислоту за раз, начиная со свободного амино-конца полипептида. цепь. Свободные аминокислоты, высвобождаемые в пищеварительную систему, затем всасываются через стенки желудочно-кишечного тракта в кровоток, где они затем повторно синтезируются в новые тканевые белки или катаболизируются для получения энергии или фрагментов для дальнейшего тканевого метаболизма.

Валовая потребность в белке была определена для нескольких видов рыб (см. Таблицу 1). Имитация цельного яичного протеина в тестовых диетах содержит избыток незаменимых аминокислот. Эти диеты поддерживались приблизительно изокалорийными за счет доведения общего белка и усвояемых углеводных компонентов до фиксированного количества, поскольку лечение белковыми диетами варьировалось в испытанных диапазонах. Испытания на кормлении мальков, сеголетков и годовалых рыб показали, что общие потребности в белке наиболее высоки у начальных кормовых мальков и что они уменьшаются по мере увеличения размера рыбы.Чтобы расти с максимальной скоростью, мальки должны иметь диету, в которой почти половина легкоусвояемых ингредиентов состоит из сбалансированного белка; через 6-8 недель это требование снижается примерно до 40 процентов рациона лосося и форели и примерно до 35 процентов рациона годовалых лососевых, выращенных при стандартной температуре окружающей среды (SET). См. Рисунки 1 и 2. Общие потребности в белке молоди сома, по-видимому, меньше, чем у лососевых. Первоначально кормление мальков требует, чтобы около 50 процентов усвояемых компонентов рациона составлял белок, и эта потребность уменьшается с увеличением размера.Некоторые испытания кормления лососем показали прямую связь между изменениями потребности в белке молоди рыбы и изменениями температуры воды. Лосось чавычи в воде с температурой 7 ° C требует около 40 процентов цельного яичного белка для максимального роста; той же рыбе в воде с температурой 15 ° C требуется около 50% белка. Лосось, форель и сом могут использовать больше белка, чем требуется для максимального роста, благодаря эффективному удалению азотистых отходов в виде растворимых соединений аммиака через ткань жабр непосредственно в водную среду.Эта система удаления азота более эффективна, чем система, доступная для птиц и млекопитающих. Птица и млекопитающие потребляют энергию для синтеза мочевины, мочевой кислоты или других соединений азота, которые выводятся через ткань почек и выводятся с мочой. Усвояемые углеводы и жиры сохранят избыток белка в рационе до тех пор, пока удовлетворяется потребность в белке для максимального роста (рисунки 1 и 2).

Таблица 1 — Расчетная потребность в белке с пищей для некоторых видов рыб 1/

Виды

Уровень сырого протеина в рационе для оптимального роста (г / кг)

Радужная форель ( Salmo gairdneri )

400-460

Карп ( Cyprinus carpio )

380

Чавыча ( Oncorhynchus tshawytscha )

400

Угорь ( Ангилья японская )

445

Камбала ( Pleuronectes platessa )

500

Серый лещ ( Chrysophrys aurata )

400

Белый амур ( Ctenopharyngodon idella )

410-430

Brycon sp.

356

Красный морской лещ ( Chrysophrys major )

550

Желтохвост ( Seriola quinqueradiata )

550

1/ По материалам C.B. Cowey, 1978

Рис. 1. Потребность в белке чавычи при 47 ° F. Верхняя кривая: исходный индивидуальный средний вес рыбы, 1.5г. Нижняя кривая: исходная индивидуальная средняя масса рыбы 5,6 г.

Рис. 2. Потребность в белке чавычи при температуре 58 ° F. Верхняя кривая: исходная индивидуальная средняя масса рыбы 2,6 г. Нижняя кривая: исходная индивидуальная средняя масса рыбы 5,8 г.

(Оба рисунка взяты из: DeLong, D.C., J.E. Halver and E.T. Mertz, 1958, J.Nutr ., 65: 589-99)

Обычно рыбе нужно давать диету, содержащую дифференцированный уровень высококачественного белка и энергии, а также адекватный баланс незаменимых жирных кислот, витаминов и минералов в течение длительного периода времени.Из полученной кривой доза / ответ потребность в белке обычно получают по графику Альмквиста. Считается, что эти различия в очевидной потребности в белке связаны с различиями в методах культивирования и составе рациона.

Относительно высокий уровень пищевого белка, необходимый для максимального роста некоторых рыб, таких как амазон, Ctenopharyngodon idella, и Brycon spp. Удивительны тем, что эти рыбы всеядны. Brycon spp.выращиваются на нежелательных фруктах и ​​другом растительном материале с низким содержанием белка, и в этих условиях, по-видимому, существенный вклад в потребление ими белка вносит естественная пищевая цепь.

Потребность в белке эвриталинных рыб, таких как радужная форель, Salmo gairdneri, и кижуч, Oncorhynchus kisutch, , выращенных в воде с соленостью 20 ppt, примерно такая же, как потребность в пресной воде. Нет данных о потребности этих видов в белке в морской воде с полной концентрацией.(35 п.


4.1 Essential и заменимые аминокислоты
4.2 Основные Аминокислоты и качество протеина


Аминокислоты являются строительными блоками белков; около 23 аминокислот были выделены из природных белков. Десять из них незаменимы для рыб. Животное не способно синтезировать незаменимые аминокислоты и поэтому должно получать их с пищей.

4.1 Незаменимые и заменимые аминокислоты

Корм ​​для лосося, форели и канального сома, лишенный аргинина, гистидина, изолейцина, лейцина, лизина, метионина, фенилаланина, треонина, триптофана или валина, не рос (рис.3). Те же самые рыбы, которых кормили рационами, лишенными других L-аминокислот, росли так же, как и рыбы, получавшие все 18 протестированных аминокислот (рис. 4). Азотный компонент в тестируемых диетах состоял из 18 L-аминокислот по образцу, обнаруженному в цельном яичном протеине. Вся тестируемая рыба быстро выздоравливала, когда в рационе была заменена недостающая аминокислота. Наклон кривой роста в группе восстановления был идентичен таковому у рыб, получавших полный тест на аминокислотный рацион.

Заменяемые аминокислоты были протестированы: аланин, аспарагиновая кислота, цистин, глутаминовая кислота, глицин, пролин, серин и тирозин.Было обнаружено, что эти аминокислоты не являются необходимыми для роста лосося, форели и канального сома.

Для количественных исследований потребностей в 10 незаменимых аминокислотах использовалась смесь казеина и желатина с добавлением кристаллических L-аминокислот. Тестируемая диета содержала 40 процентов цельного яичного белка для азотного компонента. Эксперименты, проведенные с карпом и угрем, показали аналогичное отсутствие роста, когда в рационе отсутствовала незаменимая аминокислота.

Рис. 3. Рост рыб с дефицитом аргинина. Группа с дефицитом была разделена через шесть недель на диете с дефицитом, и недостающая аминокислота была заменена в одной из двух частей.

Рис. 4. Рост рыб с дефицитом цистина.

(Оба рисунка взяты из: DeLong, D.C., J.E. Halver and E.T. Mertz, 1958, J.Nutr., 65: 589-99)

4.2 Основные аминокислоты и качество белка

Если известны потребности рыбы в незаменимых аминокислотах, должно быть возможно удовлетворить эти потребности в системах культивирования различными способами за счет различных пищевых белков или комбинаций пищевых белков.

Фенилаланин избавлен от тирозина. Неизвестно, что он химически модифицирован или становится недоступным из-за суровых условий, которым обычно подвергаются кормовые белки во время обработки. Измерение фенилаланина в белках несложно, поэтому обеспечение и оценка фенилаланина в белках в практических диетах не представляет особых трудностей.

Лизин — основная аминокислота. В дополнение к -аминокислотной группе, обычно связанной пептидной связью, она также содержит вторую, -аминогруппу.Эта α-аминогруппа должна быть свободной и реакционной, иначе лизин, хотя и поддается химическому измерению, не будет доступен биологически. Во время обработки белков корма α-аминогруппа лизина может реагировать с небелковыми молекулами, присутствующими в корме, с образованием дополнительных соединений, которые делают лизин биологически недоступным.

Цистин избавляет от метионина. Однако измерить содержание метионина в кормовых белках непросто, поскольку аминокислота подвержена окислению во время обработки.После обработки метионин может присутствовать как таковой, или как сульфоксид, или как сульфон. Сульфоксид может образовываться из метионина во время кислотного гидролиза кормового белка перед измерением его кислотного состава без содержания кислоты. Кислотный гидролиз белков перед анализом нарушает исходное равновесие между двумя соединениями, так что состав гидролизата больше не отражает состав белка. При определении содержания метионина в чистых белках окисление аминокислоты до метионинсульфона обычно является количественным.Однако в случае кормовых белков это не покажет, сколько метионина или сульфоксида метионина присутствовало в белке до его окисления и гидролиза.

Сульфоксид метионина может иметь некоторую биологическую ценность для рыб, которая может иметь некоторую способность обратного преобразования его в метионин и, таким образом, частично восполнять часть метионина, окисленного во время обработки.

Недавно появились сообщения о методах измерения метионина в белках с использованием йодоплатинатного реагента до и после восстановления трихлоридом титана, чтобы получить значения как для метионина, так и для сульфоксида в исходном белке.Также был описан способ измерения метионина конкретно по расщеплению цианогенбромида. Оба метода еще предстоит оценить независимо. Микробиологический анализ метионина в белках кормов является ценным инструментом, хотя существует опасность того, что оксиды метионина могут различаться по своей активности в отношении микроорганизмов и искажать значения.

Количественные потребности лососевых в десяти незаменимых аминокислотах определялись путем кормления линейными приращениями одной аминокислоты за раз в тестовой диете, содержащей аминокислотный профиль, идентичный цельному яичному белку, за исключением тестируемой аминокислоты.Повторяющиеся группы рыб подвергались диетическому лечению до тех пор, пока не появлялись большие различия в росте исследуемых партий. График реакции роста Альмквиста показывает уровень аминокислот, необходимый для максимального роста в этих конкретных условиях испытания. Рационы были разработаны так, чтобы содержать белок на уровне или немного ниже оптимальной потребности в белке для данного вида и условий испытаний, чтобы гарантировать максимальное использование ограничивающей аминокислоты. Сравнение требований к десяти незаменимым аминокислотам между видами показано в таблице 2.

Недавним нововведением стало использование в тестовых диетах белков, относительно дефицитных по данной незаменимой аминокислоте. Таким образом, комбинации рыбной муки и зеина использовались в тестовых диетах для определения потребности радужной форели в аргинине. Рационы, содержащие различные относительные количества казеина и желатина, показали, что увеличение уровня связанного с белками аргинина с 11 до 17 г / кг привело к значительному увеличению роста канального сома.

Таблица 2 Потребность семи животных в аминокислотах 1/

Аминокислота

Молодь угря

Карп мальки

Канальный сом

Малька чавычи

Цыпленок

Молодой поросенок

Крыса

Аргинин

3.9 (1,7 / 42)

4,3 (1,65 / 38,5)

6,0 (2,4 / 40)

6,1 (1,1 / 18)

1,5 (0,2 / 13)

1,0 (0,2 / 19)

Гистидин

1,9 (0,8 / 42)

1,8 (0,7 / 40)

1,7 (0,3 / 18)

1.5 (0,2 / 13)

2,1 (0,4 / 19)

Изолейцин

3,6 (1,5 / 42)

2,6 (1,0 / 38,5)

2,2 (0,9 / 41)

4,4 (0,8 / 18)

4,6 (0,6 / 13)

3,9 (0,5 / 13)

лейцин

4.1 (1,7 / 42)

3,9 (1,5 / 38,5)

3,9 (1,6 / 41)

6,7 (1,2 / 18)

4,6 (0,6 / 13)

4,5 (0,9 / 19)

Лизин

4,8 (2,0 / 42)

5,1 (1,23 / 24,0)

5,0 (2,0 / 40)

6.1 (1.1 / 18)

4,7 (0,65 / 13)

5,4 (1,0 / 19)

метионин 2/

4,5 (2,1 / 42) 3/

3,1 (1,2 / 38,5)

2,3 (0,56 / 24,0)

4,0 (1,6 / 40) 3/

4.4 (0,8 / 18)

3,0 (0,6 / 20)

3,0 (0,6 / 20)

Фенилаланин 4/

5,1 (2,1 / 41) 5/

7,2 (1,3 / 18)

3.6 (0,45 / 13)

5,3 (0,9 / 17)

Треонин

3,6 (1,5 / 42)

2,2 (0,9 / 40)

3,3 (0,6 / 18)

3,0 (0,4 / 13)

3,1 (0,2 / 19)

Триптофан

1,0 (0,4 / 42)

0.5 (0,2 / 40)

1,1 (0,2 / 18)

0,8 (0,2 / 25)

1,0 (0,2 / 19)

Валин

3,6 (1,5 / 42)

3,2 (1,3 / 40)

4,4 (0,8 / 18)

3,1 (0,4 / 13)

3,1 (0,4 / 13)

1/ Выражается в процентах от диетического белка.В скобках числители — это потребности в процентах от сухой диеты, а знаменатели — это процент общего содержания белка в рационе.

2/ При отсутствии цистина

3/ Метионин плюс цистин

4/ При отсутствии tyro sine

5/ Фенилаланин плюс тирозин

(по материалам: Национальный исследовательский совет, 1977 г.)

Потребность радужной форели в аргинине была определена по стандартной кривой доза / реакция (рост), а также путем измерения уровней свободного аргинина в тканях (крови и мышцах) в группах форели, получавших увеличивающееся количество аргинина в рационе.После того, как диетическая потребность форели в аргинине была удовлетворена, любое дальнейшее увеличение потребления аргинина привело к увеличению концентрации свободного аргинина в крови и мышцах. Было получено хорошее согласие между двумя методами.

Данные, представленные в таблице 2, предполагают, что между видами рыб существуют реальные различия в их потребностях в определенных аминокислотах. Это приводит к трудностям при составлении белкового компонента практического рациона для тех видов, потребности которых в аминокислотах еще не известны.Возможное решение — использовать для каждой аминокислоты наивысший уровень, необходимый для любого из тех видов, по которым имеются данные. Необходимость дополнительных количественных данных о потребностях рыб в аминокислотах, особенно тех, которые действительно или потенциально могут быть полезны в качестве сельскохозяйственных животных, очевидна.

Одним из решений использования белков, в которых относительно мало одной или нескольких аминокислот, является добавление к белку соответствующих количеств аминокислоты, необходимых в практических диетах. Рыба, по-видимому, использует свободные аминокислоты с разной степенью эффективности.

Молодой карп, Cyprinus carpio, , как было показано, неспособен расти на диетах, в которых белковый компонент (казеин, желатин) был заменен смесью аминокислот, аналогичных по общему составу. Гидролизат трипсина казеина также оказался неэффективным. Однако, если диета, содержащая свободные аминокислоты в качестве белкового компонента, тщательно нейтрализуется NaOH до pH 6,5-6,7, то некоторый рост молоди карпа действительно происходит. Этот рост был заметно хуже, чем при сопоставимой казеиновой диете в тех же условиях.

Канальный сом также не может использовать свободные аминокислоты в качестве добавок к дефицитным белкам. При изонитрогенной замене соевого шрота на муку менхадена рост и эффективность корма канального сома существенно снизились. Добавление свободного метионина, цистина или лизина, наиболее ограничивающих аминокислот, к этим заменителям сои не привело к увеличению веса.

Повышение уровня аргинина в рационе сома с 11 до 17 г / кг путем изонитрогенной замены желатина на казеин значительно увеличивало прибавку в весе, но добавление свободного аргинина, цистина, триптофана или метионина к казеину мало влияло на рост или преобразование пищи.

Лососевые могут использовать свободные аминокислоты для роста. Было показано, что зеин-желатиновая диета с добавлением лизина и тритофана заметно превосходит зеин-желатиновую диету для радужной форели, когда в качестве критериев использовались прибавка в весе и использование белка.

Несколько исследователей продемонстрировали возможность дополнения белков с дефицитом аминокислот ограничивающими аминокислотами в рационах лососевых. Казеин с добавлением шести аминокислот давал коэффициенты конверсии корма для атлантического лосося, аналогичные тем, которые были получены при использовании изолированного рыбного белка в качестве источника пищевого белка.Соевый шрот с добавлением пяти или более аминокислот (включая метионин и лизин) был лучшим источником белка для радужной форели по сравнению с одним соевым шротом. Однако однократное добавление метионина и лизина не привело к повышению ценности соевого шрота. Эти результаты предполагают, что аминокислотный спектр выделенного рыбьего белка, который они использовали, может приблизительно соответствовать потребности в аминокислотах радужной форели. Пищевая ценность изолята соевого белка может быть увеличена путем добавления в него первой ограничивающей аминокислоты; я.е., метионин.

Рационы, содержащие в качестве белкового компонента рыбную муку, мясокостную муку, а также дрожжевую и соевую муку, можно улучшить, добавляя цистин (10 г / кг) и триптофан (5 г / кг) вместе. Рыбную муку можно полностью заменить без снижения коэффициента конверсии корма в рационах для радужной форели смесью из субпродуктов домашней птицы и перьевой муки вместе с 17 г лизина HCL / кг, 4,8 г DL-метионина / кг и 1,44 г DL. -триптофан / кг.

Коуи, К.Б. и Дж. Р. Сардженты, 1972 Кормление рыб. Adv. Mar.Biol., 10: 383-492

Cowey, C.B., 1979 Потребности рыб в белках и аминокислотах. В Технология кормления и кормления рыб для рыб, под редакцией Дж. Э. Халвера и К. Тьюса. Материалы Всемирного симпозиума, спонсируемого EIFAC / FAO, ICES и IUNS, Гамбург, 20–23 июня 1978 г. Schr . Bundesforschungsanst . Fisch ., Hamb ., (14/15) vol. 1: 3-16

Мерц, Э.Т., 1972 г. Потребности в белке и аминокислотах. В Питание рыб, под редакцией Дж. Э. Халвера. Нью-Йорк, Academic Press, стр. 106-43.

Национальный исследовательский совет, Подкомитет по тепловодным рыбам 1977 года, Потребности теплопроводных рыб в питательных веществах. Вашингтон, округ Колумбия, Национальная академия наук (потребности домашних животных в питательных веществах) 78 стр.


Белковые концентраты и текстурированные белковые вещества (HS: 210610) Торговля продуктами, экспортеры и импортеры | OEC

Обзор Эта страница содержит последние данные о торговле белковыми концентратами и текстурированными белковыми веществами.В 2019 году белковых концентратов и текстурированных белковых веществ заняли 1214-е место в мире по объему торгов с общим объемом продаж 2,23 млрд долларов. В период с 2018 по 2019 год экспорт белковых концентратов и текстурированных белковых веществ вырос на 0,12%, с 2,23 млрд долларов до 2,23 млрд долларов. Торговля Белковые концентраты и текстурированные белковые вещества составляют 0,012% от общего объема мировой торговли.

Белковые концентраты и текстурированные белковые вещества входят в состав прочих пищевых продуктов.

Экспорт В 2019 году крупнейшими экспортерами белковых концентратов и текстурированных белковых веществ были США (806 млн долларов), Китай (238 млн долларов), Нидерланды (183 млн долларов), Великобритания (174 млн долларов) и Франция. (76,4 млн долларов).

Импорт В 2019 году крупнейшими импортерами белковых концентратов и текстурированных белковых веществ были Нидерланды (156 млн долларов), Канада (153 млн долларов), Великобритания (125 млн долларов), США (118 млн долларов), и Германия (104 миллиона долларов).

Тарифы В 2018 году средний тариф на Белковые концентраты и текстурированные белковые вещества составил 14,8%, что сделало его 1116-м наименьшим тарифом по классификации продуктов HS6.

Страны с самыми высокими импортными пошлинами на Белковые концентраты и текстурированные белковые вещества — это Австрия (147%), Япония (48,8%), Багамы (37,3%), Тунис (36%) и Камбоджа (35%). ). Страны с самыми низкими тарифами — Маврикий (0%), Гонконг (0%), Мальдивы (0%), Сингапур (0%) и Швейцария (0%).

Рейтинг Белковые концентраты и текстурированные белковые вещества занимает 2306 место в Индексе сложности продукта (PCI).

Экспорт в Китай: прочие белковые вещества и их производные | Экономические показатели

Экспорт Китая: вице-президент: съедобные овощи и некоторые корнеплоды и клубни (млн долл. США) 953,268 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт Китая hs: BM: Iron & Steel (млн долл. США) 5,521.032 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт в Китай hs: BM: Другой недрагоценный металл; Кермет; Статья (млн долл. США) 525 590 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
China Export hs: FB: Сахар и кондитерские изделия из сахара (млн долл. США) 162.773 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китайские экспортные товары: OP: Clock & Watch & их части (млн долл. США) 399.650 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт hs: LP: живые животные (млн долл. США) 79.619 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт Китая hs: VP: съедобные фрукты и орехи; Цедра цитрусовых или дыни (млн долл. США) 671,454 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт hs: VP: Продукция мукомольной промышленности; Солод; Крахмал; Инулин; Пшеница Гл… (млн долл. США) 167,977 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт Китая hs: пластмассы и изделия из них; Резина и изделия из нее: пластик и … (млн долл. США) 6 521 689 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт в Китай hs: TA: шерсть, тонкая или грубая шерсть животных; Пряжа и тканые материалы из конского волоса Fa… (млн долл. США) 147,909 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт Китая hs: TA: Искусственное штапельное волокно (млн долл. США) 1 049,078 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт из Китая hs: RH: необработанные шкуры и кожа, кроме меховой кожи и кожи (млн долл. США) 360.553 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт Китая hs: TA: Прочие изделия из текстиля; Набор; Поношенная одежда и поношенные … (млн долл. США) 3 826,052 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китайский импорт hs: TA: Прочие изделия из текстиля; Набор; Поношенная одежда и поношенное Te… (млн долл. США) 32,025 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт Китая hs: TA: Искусственное штапельное волокно (млн долл. США) 151,885 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт Китая hs: CA: Прочие химические продукты (млн долл. США) 2,445.020 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт Китая hs: BM: свинец и изделия из него (млн долл. США) 6,520 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
China Export hs: VA: Железнодорожный или трамвайный локомотив, подвижной состав и его части… (млн долл. США) 2 483 897 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт hs: ME: ядерный реактор, котел, оборудование и механические устройства; … (млн долл. США) 17 802 049 Октябрь 2021 г. ежемесячно Янв.1999 г .— октябрь 2021 г.
Китай Импорт hs: FB: какао и какао-продукты (млн долл. США) 128.162 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт Китая hs: BM: олово и изделия из него (млн долл. США) 27,658 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт Китая hs: TA: Предмет одежды и аксессуары для одежды, вязанные или связанные крючком… (млн долл. США) 8 852 375 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт в Китай hs: RH: Меховая кожа и искусственный мех; Их производство (млн долл. США) 270,459 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт hs: VP: съедобные фрукты и орехи; Цедра цитрусовых или дыни (млн долл. США) 771.611 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт HS: MA: Мебель; Постельное белье, матрас, опора для матраса, подушка и ткань … (млн долларов США) 232,736 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт Китая hs: BM: Прочие изделия из недрагоценных металлов (млн долл. США) 2,365.500 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт hs: VP: масличные семена и масличные фрукты; Разное зерно, семена и фрукты … (млн долл. США) 3,552,419 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китайские импортные hs: вице-президент: живые деревья и другие растения; Луковица, корень и тому подобное; Срезанный цветок… (млн долл. США) 25 283 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт Китая hs: MA: игрушки, игры и спортивный инвентарь; Их части и принадлежности (млн долл. США) 10 739 981 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт из Китая hs: FB: Готовка из мяса, рыбы или ракообразных, моллюсков или других продуктов A… (млн долл. США) 27,156 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт hs: TA: Искусственные нити (млн долл. США) 235,745 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт hs: RH: Изделие из кожи; Шорно-седельные изделия и упряжь; Товары для путешествий, Handb… (млн долл. США) 556,282 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт HS: VP: Lac; Камедь, смола и другие растительные соки и экстракты (млн долл. США) 35,944 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт hs: CA: удобрения (млн долл. США) 245.289 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт из Китая hs: TA: трикотаж или вязаное полотно (млн долл. США) 93,234 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт Китая hs: BM: Прочие изделия из недрагоценных металлов (млн долл. США) 175.266 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт HS: CA: взрывоопасный; Пиротехнический продукт; Совпадение; Пирофорный сплав; Ce … (млн долл. США) 10,117 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт Китая hs: BM: алюминий и изделия из него (млн долл. США) 1,217.447 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт HS: BM: Прочие недрагоценные металлы; Кермет; Статья (млн долл. США) 424,141 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт HS: MA: Прочие промышленные товары (млн долл. США) 179.824 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт в Китай: GC: меховая одежда (по единицам) (единица tt) 30,000 Октябрь 2021 г. ежемесячно Янв 2008 — октябрь 2021
Импорт из Китая: стальной прокат: угол, форма и сечение (млн долл. США) 25.051 Декабрь 2019 ежемесячно Янв 2001 — декабрь 2019
Импорт из Китая: автотранспортные средства: грузовые автомобили (млн долл. США) 12,173 Октябрь 2021 г. ежемесячно Январь 1993 — октябрь 2021
Экспорт: Китай (Шанхай) экспериментальная зона свободной торговли (млн долл. США) 2,977.219 Декабрь 2015 ежемесячно Янв 2014 — декабрь 2015
Экспорт Китая: интегрированная облигационная зона (МБА) (млн долл. США) 46 429 022 Октябрь 2021 г. ежемесячно Март 2009 г. — октябрь 2021 г.
Импорт Китая: зона экспортной обработки (ЗЭП) (млн долл. США) 2,546.409 Декабрь 2020 ежемесячно Янв 2001 — декабрь 2020
Китайские экспортные hs: вице-президент по масличным семенам и масличным фруктам; Разное зерно, семена и фрукты … (млн долл. США) 223,781 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт в Китай hs: VA: Транспортное средство, кроме железнодорожного или трамвайного подвижного состава, запчасти и… (млн долл. США) 11 120 937 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт hs: PW: древесная масса или другой волокнистый целлюлозный материал; Отходы и … (млн долл. США) 1 678 732 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт из Китая: текстильная пряжа, ткань и готовые изделия (TY): шерстяная пряжа (тонны) 257.000 Декабрь 2019 ежемесячно Янв 1993 — декабрь 2019
Экспорт из Китая: Азия: Корея, КНДР (млн долл. США) 39,784 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Азия: Иордания (млн долл. США) 400.977 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Азия: Лаос, НДР (млн долл. США) 85,017 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Азия: Узбекистан (млн долл. США) 493.233 Сен 2021 ежемесячно Янв.2003 г. — сентябрь 2021 г.
Экспорт Китая: Азия: Таджикистан (млн долл. США) 207 236 Сен 2021 ежемесячно Янв.2003 г. — сентябрь 2021 г.
Экспорт из Китая: Африка: Камерун (млн долл. США) 245.215 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт из Китая: Африка: Зимбабве (млн долл. США) 86,973 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Африка: Нигерия (млн долл. США) 1999.360 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт из Китая: Африка: Конго, ДР (млн долл. США) 262,481 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Европа: Румыния (млн долл. США) 699.377 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт из Китая: Европа: Исландия (млн долл. США) 26,319 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Европа: Мальта (млн долл. США) 239.212 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Европа: Словения (млн долл. США) 517.957 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт из Китая: Европа: Норвегия (млн долл. США) 324.991 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Европа: Армения (млн долл. США) 30,128 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Латинская Америка: Антигуа и Барбуда (млн долл. США) 5.723 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт из Китая: Азия: Кипр (млн долл. США) 56,061 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Азия: Мьянма (млн долл. США) 798.336 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Азия: Катар (млн долл. США) 376,992 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Латинская Америка: Аруба (млн долл. США) 19.133 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт из Китая: Африка: Алжир (млн долл. США) 392,419 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Латинская Америка: прочие (млн долл. США) 0.651 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Азия: Объединенные Арабские Эмираты (млн долл. США) 3 508 045 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт Китая: Азия: Восточный Тимор (млн долл. США) 21.539 Сен 2021 ежемесячно Янв.2003 г. — сентябрь 2021 г.
Экспорт из Китая: Латинская Америка: Гайана (млн долл. США) 26,874 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Африка: Бенин (млн долл. США) 106.902 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Латинская Америка: Сен-Пьер и Микелон (млн долл. США) 0,000 Октябрь 2021 г. ежемесячно Ноя 2002 — октябрь 2021
Экспорт из Китая: Африка: Канарские острова (млн долл. США) 0.172 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Африка: Кот-д’Ивуар (млн долл. США) 283,404 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт из Китая: Океания: острова Туамоту (млн долл. США) 0.000 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт из Китая: Африка: Мозамбик (млн долл. США) 258,312 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Африка: Бурунди (млн долл. США) 17.385 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Африка: Сомали (млн долл. США) 88,163 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт из Китая: Азия: Иордания (млн долл. США) 30.089 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Китай Импорт: Азия: Афганистан (млн долл. США) 0,613 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт из Китая: Азия: Корея, ДНР (млн долл. США) 1.997 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Африка: Нигер (млн долл. США) 55,929 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт из Китая: Африка: Канарские острова (млн долл. США) 0.000 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Европа: Молдова (млн долл. США) 13 974 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Китай Импорт: Азия: Йемен (млн долл. США) 0.500 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Импорт из Китая: Азия: Непал (млн долл. США) 2,709 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт из Китая: Европа: Черногория (млн долл. США) 7.408 Октябрь 2021 г. ежемесячно Март 2007 г. — октябрь 2021 г.
Экспорт из Китая: Европа: Албания (млн долл. США) 54,170 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Экспорт из Китая: Европа: Монако (млн долл. США) 0.413 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт из Китая: Африка: Танзания (млн долл. США) 65,518 Октябрь 2021 г. ежемесячно Янв.2001 — октябрь 2021
Импорт из Китая: Африка: Гамбия (млн долл. США) 4.897 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт из Китая: Латинская Америка: Мексика (млн долл. США) 6 275 230 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Импорт из Китая: Африка: Мали (млн долл. США) 5.022 Сен 2021 ежемесячно Янв.2001 — сентябрь 2021
Экспорт из Китая: Латинская Америка: Аргентина (млн долл. США) 1 011 356 Сен 2021 ежемесячно Янв.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *

2022 © Все права защищены.